DKFZP564O0523 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: DKFZP564O0523 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324929
• Hersteller Artikelnummer: orb324929
• Alternativnummer: BYT-ORB324929-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DKFZP564O0523
• Konjugation: Unconjugated
• Alternative Synonym: anti DKFZp686D1651 antibody, anti HSPC304 antibody, anti C7orf64 antibody, anti DKFZP564O0523 antibody

Produktbeschreibung

Rabbit polyclonal antibody to RBM48

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 42kDa
• NCBI: 115496
• UniProt: Q5RL73
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK
• Target-Kategorie: RBM48

Bilder

WB Suggested Anti-DKFZP564O0523 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that RBM48 is expressed in MCF7.