DKFZP564O0523 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: DKFZP564O0523 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324929
• Supplier Catalog Number: orb324929
• Alternative Catalog Number: BYT-ORB324929-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DKFZP564O0523
• Conjugation: Unconjugated
• Alternative Names: anti DKFZp686D1651 antibody, anti HSPC304 antibody, anti C7orf64 antibody, anti DKFZP564O0523 antibody

Product Description

Rabbit polyclonal antibody to RBM48

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 42kDa
• NCBI: 115496
• UniProt: Q5RL73
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK
• Target: RBM48

Images

WB Suggested Anti-DKFZP564O0523 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that RBM48 is expressed in MCF7.