TTC14 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324934
| Artikelname: |
TTC14 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324934 |
| Hersteller Artikelnummer: |
orb324934 |
| Alternativnummer: |
BYT-ORB324934-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human TTC14 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti DKFZp313M1015 antibody, anti DRDL5813 antibody, anti FLJ00166 antibody, anti KIAA1980 antibody, anti PRO19630 antibody |
| Rabbit polyclonal antibody to TTC14 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
88kDa |
| NCBI: |
597719 |
| UniProt: |
Q96N46 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK |
| Target-Kategorie: |
TTC14 |
![]()
|
WB Suggested Anti-TTC14 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate. |
