TTC14 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324934
Article Name: TTC14 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324934
Supplier Catalog Number: orb324934
Alternative Catalog Number: BYT-ORB324934-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TTC14
Conjugation: Unconjugated
Alternative Names: anti DKFZp313M1015 antibody, anti DRDL5813 antibody, anti FLJ00166 antibody, anti KIAA1980 antibody, anti PRO19630 antibody
Rabbit polyclonal antibody to TTC14
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 88kDa
NCBI: 597719
UniProt: Q96N46
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK
Target: TTC14
WB Suggested Anti-TTC14 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.