SLC6A2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SLC6A2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324970
• Hersteller Artikelnummer: orb324970
• Alternativnummer: BYT-ORB324970-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2
• Konjugation: Unconjugated
• Alternative Synonym: anti NAT1 antibody, anti NET antibody, anti NET1 antibody, anti SLC6A5 antibody

Produktbeschreibung

Rabbit polyclonal antibody to SLC6A2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 69kDa
• NCBI: 001034
• UniProt: P23975
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF
• Target-Kategorie: SLC6A2

Bilder

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.