SLC6A2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SLC6A2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324970
• Supplier Catalog Number: orb324970
• Alternative Catalog Number: BYT-ORB324970-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2
• Conjugation: Unconjugated
• Alternative Names: anti NAT1 antibody, anti NET antibody, anti NET1 antibody, anti SLC6A5 antibody

Product Description

Rabbit polyclonal antibody to SLC6A2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 69kDa
• NCBI: 001034
• UniProt: P23975
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF
• Target: SLC6A2

Images

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.