The immunogen is a synthetic peptide directed towards the middle region of human C1orf166
Konjugation:
Unconjugated
Alternative Synonym:
anti FLJ12875 antibody, anti RP11-401M16.2 antibody, anti GIDE antibody, anti MAPL antibody, anti MULAN antibody, anti RNF218 antibody, anti C1orf166 antibody
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
Target-Kategorie:
MUL1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL ug/mL of the antibody was used in this experiment. 40 kDa band likely has ubiquitin crosslinks and smaller isoforms of 34 kDa and 28 kDa also contain this peptide sequence.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/mL.
Positive control (+): Human kidney (KI), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.