C1orf166 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: C1orf166 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325073
• Supplier Catalog Number: orb325073
• Alternative Catalog Number: BYT-ORB325073-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf166
• Conjugation: Unconjugated
• Alternative Names: anti FLJ12875 antibody, anti RP11-401M16.2 antibody, anti GIDE antibody, anti MAPL antibody, anti MULAN antibody, anti RNF218 antibody, anti C1orf166 antibody

Product Description

Rabbit polyclonal antibody to MUL1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 40 kDa
• NCBI: 078820
• UniProt: Q969V5
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
• Target: MUL1

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL ug/mL of the antibody was used in this experiment. 40 kDa band likely has ubiquitin crosslinks and smaller isoforms of 34 kDa and 28 kDa also contain this peptide sequence.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/mL.

Positive control (+): Human kidney (KI), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.

WB Suggested Anti-C1orf166 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.