TYRP1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: TYRP1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB325137
• Hersteller Artikelnummer: orb325137
• Alternativnummer: BYT-ORB325137-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TYRP1
• Konjugation: Unconjugated
• Alternative Synonym: anti CAS2 antibody, anti CATB antibody, anti GP75 antibody, anti TRP antibody, anti TYRP antibody, anti b-PROTEIN antibody

Produktbeschreibung

Rabbit polyclonal antibody to TYRP1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 61 kDa
• NCBI: 000541
• UniProt: P17643
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
• Target-Kategorie: TYRP1

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is expressed as 61 kDa preprotein and is processed to approximately 56 kDa. It is also highly glycosylated.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Type: Human 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Rabbit Anti-TYRP1 Antibody, Paraffin Embedded Tissue: Human Skin, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-TYRP1 Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.