TYRP1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325137
Article Name: TYRP1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325137
Supplier Catalog Number: orb325137
Alternative Catalog Number: BYT-ORB325137-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TYRP1
Conjugation: Unconjugated
Alternative Names: anti CAS2 antibody, anti CATB antibody, anti GP75 antibody, anti TRP antibody, anti TYRP antibody, anti b-PROTEIN antibody
Rabbit polyclonal antibody to TYRP1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 61 kDa
NCBI: 000541
UniProt: P17643
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
Target: TYRP1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is expressed as 61 kDa preprotein and is processed to approximately 56 kDa. It is also highly glycosylated.
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Type: Human 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.
Rabbit Anti-TYRP1 Antibody, Paraffin Embedded Tissue: Human Skin, Antibody Concentration: 5 ug/mL.
WB Suggested Anti-TYRP1 Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.