Prd Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325373
| Artikelname: |
Prd Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325373 |
| Hersteller Artikelnummer: |
orb325373 |
| Alternativnummer: |
BYT-ORB325373-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Drosophila |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Dmel_CG6716 antibody, anti CG6716 antibody, anti Prd antibody, anti pr antibody, anti Dmel\CG6716 antibody, anti PRD antibody |
| Rabbit polyclonal antibody to prd |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
65kDa |
| NCBI: |
723721 |
| UniProt: |
P06601 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL |
| Target-Kategorie: |
prd |
