Prd Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325373
Artikelname: Prd Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325373
Hersteller Artikelnummer: orb325373
Alternativnummer: BYT-ORB325373-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Drosophila
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Konjugation: Unconjugated
Alternative Synonym: anti Dmel_CG6716 antibody, anti CG6716 antibody, anti Prd antibody, anti pr antibody, anti Dmel\CG6716 antibody, anti PRD antibody
Rabbit polyclonal antibody to prd
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 65kDa
NCBI: 723721
UniProt: P06601
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
Target-Kategorie: prd