Prd Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325373
| Article Name: |
Prd Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325373 |
| Supplier Catalog Number: |
orb325373 |
| Alternative Catalog Number: |
BYT-ORB325373-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Drosophila |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti Dmel_CG6716 antibody, anti CG6716 antibody, anti Prd antibody, anti pr antibody, anti Dmel\CG6716 antibody, anti PRD antibody |
| Rabbit polyclonal antibody to prd |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
65kDa |
| NCBI: |
723721 |
| UniProt: |
P06601 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL |
| Target: |
prd |
