KIAA0515 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: KIAA0515 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB325381
• Hersteller Artikelnummer: orb325381
• Alternativnummer: BYT-ORB325381-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0515
• Konjugation: Unconjugated
• Alternative Synonym: anti RP11-334J6.1 antibody, anti DKFZp781F05101 antibody, anti DKFZp781K12107 antibody, anti LQFBS-1 antibody, anti MGC10526 antibody, anti BAT2L antibody, anti BAT2L1 antibody, anti KIAA0515 antibody

Produktbeschreibung

Rabbit polyclonal antibody to PRRC2B

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 48kDa
• NCBI: 87968
• UniProt: Q5JSZ5
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK
• Target-Kategorie: PRRC2B