KIAA0515 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: KIAA0515 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325381
• Supplier Catalog Number: orb325381
• Alternative Catalog Number: BYT-ORB325381-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0515
• Conjugation: Unconjugated
• Alternative Names: anti RP11-334J6.1 antibody, anti DKFZp781F05101 antibody, anti DKFZp781K12107 antibody, anti LQFBS-1 antibody, anti MGC10526 antibody, anti BAT2L antibody, anti BAT2L1 antibody, anti KIAA0515 antibody

Product Description

Rabbit polyclonal antibody to PRRC2B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 48kDa
• NCBI: 87968
• UniProt: Q5JSZ5
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK
• Target: PRRC2B