SELENOS Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SELENOS Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB325385
• Hersteller Artikelnummer: orb325385
• Alternativnummer: BYT-ORB325385-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SELS
• Konjugation: Unconjugated
• Alternative Synonym: anti AD-015 antibody, anti ADO15 antibody, anti MGC104346 antibody, anti MGC2553 antibody, anti SBBI8 antibody, anti SEPS1 antibody, anti VIMP antibody, anti SELS antibody

Produktbeschreibung

Rabbit polyclonal antibody to VIMP

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 21kDa
• NCBI: 060915
• UniProt: Q9BQE4
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
• Target-Kategorie: SELENOS