SELENOS Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SELENOS Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325385
• Supplier Catalog Number: orb325385
• Alternative Catalog Number: BYT-ORB325385-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SELS
• Conjugation: Unconjugated
• Alternative Names: anti AD-015 antibody, anti ADO15 antibody, anti MGC104346 antibody, anti MGC2553 antibody, anti SBBI8 antibody, anti SEPS1 antibody, anti VIMP antibody, anti SELS antibody

Product Description

Rabbit polyclonal antibody to VIMP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 21kDa
• NCBI: 060915
• UniProt: Q9BQE4
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
• Target: SELENOS