KIZ Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325392
| Artikelname: |
KIZ Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325392 |
| Hersteller Artikelnummer: |
orb325392 |
| Alternativnummer: |
BYT-ORB325392-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf19 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti-C20orf19 antibody, anti-centrosomal protein kizuna antibody, anti-HT013 antibody, anti-Kiz antibody, anti-Kizuna antibody, anti-PLK1S1 antibody, anti-Polo-like kinase 1 substrate 1 antibody, anti-Uncharacterized protein C20orf19 antibody |
| Rabbit polyclonal antibody to KIZUNA |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
75kDa |
| NCBI: |
060944 |
| UniProt: |
Q2M2Z5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD |
| Target-Kategorie: |
KIZ |
