KIZ Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325392
| Article Name: |
KIZ Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325392 |
| Supplier Catalog Number: |
orb325392 |
| Alternative Catalog Number: |
BYT-ORB325392-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf19 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti-C20orf19 antibody, anti-centrosomal protein kizuna antibody, anti-HT013 antibody, anti-Kiz antibody, anti-Kizuna antibody, anti-PLK1S1 antibody, anti-Polo-like kinase 1 substrate 1 antibody, anti-Uncharacterized protein C20orf19 antibody |
| Rabbit polyclonal antibody to KIZUNA |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
75kDa |
| NCBI: |
060944 |
| UniProt: |
Q2M2Z5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD |
| Target: |
KIZ |
