Gyg Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325406
| Artikelname: |
Gyg Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325406 |
| Hersteller Artikelnummer: |
orb325406 |
| Alternativnummer: |
BYT-ORB325406-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti AU017667 antibody, anti Gyg1 antibody |
| Rabbit polyclonal antibody to Gyg |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
39 kDa |
| NCBI: |
038783 |
| UniProt: |
Q9R062 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ |
| Target-Kategorie: |
Gyg |
