Gyg Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325406
Article Name: Gyg Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325406
Supplier Catalog Number: orb325406
Alternative Catalog Number: BYT-ORB325406-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Unconjugated
Alternative Names: anti AU017667 antibody, anti Gyg1 antibody
Rabbit polyclonal antibody to Gyg
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 39 kDa
NCBI: 038783
UniProt: Q9R062
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
Target: Gyg