POLR1D Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: POLR1D Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB325415
• Hersteller Artikelnummer: orb325415
• Alternativnummer: BYT-ORB325415-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLR1D
• Konjugation: Unconjugated
• Alternative Synonym: anti FLJ20616 antibody, anti MGC9850 antibody, anti POLR1C antibody, anti RPA16 antibody, anti RPA9 antibody, anti RPAC2 antibody, anti RPO1-3 antibody, anti AC19 antibody, anti TCS2 antibody, anti RPC16 antibody

Produktbeschreibung

Rabbit polyclonal antibody to POLR1D

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 15kDa
• NCBI: 057056
• UniProt: Q9Y2S0
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
• Target-Kategorie: POLR1D