POLR1D Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: POLR1D Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325415
• Supplier Catalog Number: orb325415
• Alternative Catalog Number: BYT-ORB325415-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLR1D
• Conjugation: Unconjugated
• Alternative Names: anti FLJ20616 antibody, anti MGC9850 antibody, anti POLR1C antibody, anti RPA16 antibody, anti RPA9 antibody, anti RPAC2 antibody, anti RPO1-3 antibody, anti AC19 antibody, anti TCS2 antibody, anti RPC16 antibody

Product Description

Rabbit polyclonal antibody to POLR1D

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 15kDa
• NCBI: 057056
• UniProt: Q9Y2S0
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
• Target: POLR1D