AS3MT Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325426
| Artikelname: |
AS3MT Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325426 |
| Hersteller Artikelnummer: |
orb325426 |
| Alternativnummer: |
BYT-ORB325426-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human AS3MT |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CYT19 antibody, anti RP11-753C18.6 antibody |
| Rabbit polyclonal antibody to AS3MT |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
42 kDa |
| NCBI: |
065733 |
| UniProt: |
Q9HBK9 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL |
| Target-Kategorie: |
AS3MT |
