AS3MT Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325426
| Article Name: |
AS3MT Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325426 |
| Supplier Catalog Number: |
orb325426 |
| Alternative Catalog Number: |
BYT-ORB325426-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human AS3MT |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti CYT19 antibody, anti RP11-753C18.6 antibody |
| Rabbit polyclonal antibody to AS3MT |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
42 kDa |
| NCBI: |
065733 |
| UniProt: |
Q9HBK9 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL |
| Target: |
AS3MT |
