MAP2K7 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325434
| Artikelname: |
MAP2K7 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325434 |
| Hersteller Artikelnummer: |
orb325434 |
| Alternativnummer: |
BYT-ORB325434-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MP2K7 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti MAP2K7 antibody, anti JNKK2 antibody, anti MEK7 antibody, anti MKK7 antibody, anti PRKMK7 antibody, anti SKK4 antibody, anti antibody |
| Rabbit polyclonal antibody to MP2K7 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
50kDa |
| UniProt: |
O14733 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: KDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTS |
| Target-Kategorie: |
MAP2K7 |
