MAP2K7 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325434
| Article Name: |
MAP2K7 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325434 |
| Supplier Catalog Number: |
orb325434 |
| Alternative Catalog Number: |
BYT-ORB325434-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MP2K7 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti MAP2K7 antibody, anti JNKK2 antibody, anti MEK7 antibody, anti MKK7 antibody, anti PRKMK7 antibody, anti SKK4 antibody, anti antibody |
| Rabbit polyclonal antibody to MP2K7 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
50kDa |
| UniProt: |
O14733 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: KDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTS |
| Target: |
MAP2K7 |
