MAP2K7 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325434
Article Name: MAP2K7 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325434
Supplier Catalog Number: orb325434
Alternative Catalog Number: BYT-ORB325434-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MP2K7
Conjugation: Unconjugated
Alternative Names: anti MAP2K7 antibody, anti JNKK2 antibody, anti MEK7 antibody, anti MKK7 antibody, anti PRKMK7 antibody, anti SKK4 antibody, anti antibody
Rabbit polyclonal antibody to MP2K7
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 50kDa
UniProt: O14733
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: KDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTS
Target: MAP2K7