C14orf172 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325435
| Artikelname: |
C14orf172 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325435 |
| Hersteller Artikelnummer: |
orb325435 |
| Alternativnummer: |
BYT-ORB325435-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf172 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti FLJ40452 antibody, anti GCD14 antibody, anti Gcd14p antibody, anti TRM61 antibody, anti hTRM61 antibody, anti C14orf172 antibody |
| Rabbit polyclonal antibody to TRMT61A |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
31kDa |
| NCBI: |
689520 |
| UniProt: |
Q96FX7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI |
| Target-Kategorie: |
TRMT61A |
