C14orf172 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325435
| Article Name: |
C14orf172 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325435 |
| Supplier Catalog Number: |
orb325435 |
| Alternative Catalog Number: |
BYT-ORB325435-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf172 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti FLJ40452 antibody, anti GCD14 antibody, anti Gcd14p antibody, anti TRM61 antibody, anti hTRM61 antibody, anti C14orf172 antibody |
| Rabbit polyclonal antibody to TRMT61A |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
31kDa |
| NCBI: |
689520 |
| UniProt: |
Q96FX7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI |
| Target: |
TRMT61A |
