GGTL3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325446
| Artikelname: |
GGTL3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325446 |
| Hersteller Artikelnummer: |
orb325446 |
| Alternativnummer: |
BYT-ORB325446-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human GGTL3 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti D20S101 antibody, anti GGTL5 antibody, anti dJ18C9.2 antibody, anti GGT4 antibody, anti GGTL3 antibody |
| Rabbit polyclonal antibody to GGT7 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
70kDa |
| NCBI: |
821158 |
| UniProt: |
B5MD39 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC |
| Target-Kategorie: |
GGT7 |
