GGTL3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325446
| Article Name: |
GGTL3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325446 |
| Supplier Catalog Number: |
orb325446 |
| Alternative Catalog Number: |
BYT-ORB325446-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human GGTL3 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti D20S101 antibody, anti GGTL5 antibody, anti dJ18C9.2 antibody, anti GGT4 antibody, anti GGTL3 antibody |
| Rabbit polyclonal antibody to GGT7 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
70kDa |
| NCBI: |
821158 |
| UniProt: |
B5MD39 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC |
| Target: |
GGT7 |
