NUDT1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325449
Artikelname: NUDT1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325449
Hersteller Artikelnummer: orb325449
Alternativnummer: BYT-ORB325449-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human 8ODP
Konjugation: Unconjugated
Alternative Synonym: anti NUDT1 antibody, anti MTH1 antibody, anti antibody
Rabbit polyclonal antibody to 8ODP
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 21kDa
UniProt: P36639
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: WNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
Target-Kategorie: NUDT1