NUDT1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325449
| Article Name: |
NUDT1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325449 |
| Supplier Catalog Number: |
orb325449 |
| Alternative Catalog Number: |
BYT-ORB325449-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human 8ODP |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti NUDT1 antibody, anti MTH1 antibody, anti antibody |
| Rabbit polyclonal antibody to 8ODP |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
21kDa |
| UniProt: |
P36639 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: WNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM |
| Target: |
NUDT1 |
