FAM62B Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325485
Artikelname: FAM62B Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325485
Hersteller Artikelnummer: orb325485
Alternativnummer: BYT-ORB325485-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM62B
Konjugation: Unconjugated
Alternative Synonym: anti CHR2SYT antibody, anti ESYT2 antibody, anti KIAA1228 antibody, anti E-Syt2 antibody, anti FAM62B antibody
Rabbit polyclonal antibody to ESYT2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 102 kDa
NCBI: 065779
UniProt: A0FGR8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Target-Kategorie: ESYT2