FAM62B Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325485
Article Name: FAM62B Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325485
Supplier Catalog Number: orb325485
Alternative Catalog Number: BYT-ORB325485-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM62B
Conjugation: Unconjugated
Alternative Names: anti CHR2SYT antibody, anti ESYT2 antibody, anti KIAA1228 antibody, anti E-Syt2 antibody, anti FAM62B antibody
Rabbit polyclonal antibody to ESYT2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 102 kDa
NCBI: 065779
UniProt: A0FGR8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Target: ESYT2