Aadacl1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325487
| Artikelname: |
Aadacl1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325487 |
| Hersteller Artikelnummer: |
orb325487 |
| Alternativnummer: |
BYT-ORB325487-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Aadacl1 antibody, anti B230106I24Rik antibody, anti CPO-BP antibody, anti Nceh antibody |
| Rabbit polyclonal antibody to Nceh1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
46kDa |
| NCBI: |
848887 |
| UniProt: |
Q8BLF1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS |
| Target-Kategorie: |
Nceh1 |
