Aadacl1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325487
| Article Name: |
Aadacl1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325487 |
| Supplier Catalog Number: |
orb325487 |
| Alternative Catalog Number: |
BYT-ORB325487-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti Aadacl1 antibody, anti B230106I24Rik antibody, anti CPO-BP antibody, anti Nceh antibody |
| Rabbit polyclonal antibody to Nceh1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
46kDa |
| NCBI: |
848887 |
| UniProt: |
Q8BLF1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS |
| Target: |
Nceh1 |
