NTN4 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325495
Artikelname: NTN4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325495
Hersteller Artikelnummer: orb325495
Alternativnummer: BYT-ORB325495-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NTN4
Konjugation: Unconjugated
Alternative Synonym: anti FLJ23180 antibody, anti PRO3091 antibody
Rabbit polyclonal antibody to NTN4
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 70kDa
NCBI: 067052
UniProt: Q9HB63
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
Target-Kategorie: NTN4