NTN4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325495
| Article Name: |
NTN4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325495 |
| Supplier Catalog Number: |
orb325495 |
| Alternative Catalog Number: |
BYT-ORB325495-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human NTN4 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti FLJ23180 antibody, anti PRO3091 antibody |
| Rabbit polyclonal antibody to NTN4 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
70kDa |
| NCBI: |
067052 |
| UniProt: |
Q9HB63 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY |
| Target: |
NTN4 |
