KLB Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: KLB Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB325853
• Hersteller Artikelnummer: orb325853
• Alternativnummer: BYT-ORB325853-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLB
• Konjugation: Unconjugated
• Alternative Synonym: anti BKL antibody, anti MGC142213 antibody

Produktbeschreibung

Rabbit polyclonal antibody to KLB

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 120 kDa
• NCBI: 783864
• UniProt: Q86Z14
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
• Target-Kategorie: KLB

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.

Human Testis

Immunohistochemistry of formalin-fixed, paraffin-embedded human colon tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

Immunohistochemistry of formalin-fixed, paraffin-embedded human testis tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

WB Suggested Anti-KLB Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.