KLB Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: KLB Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325853
• Supplier Catalog Number: orb325853
• Alternative Catalog Number: BYT-ORB325853-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLB
• Conjugation: Unconjugated
• Alternative Names: anti BKL antibody, anti MGC142213 antibody

Product Description

Rabbit polyclonal antibody to KLB

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 120 kDa
• NCBI: 783864
• UniProt: Q86Z14
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
• Target: KLB

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.

Human Testis

Immunohistochemistry of formalin-fixed, paraffin-embedded human colon tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

Immunohistochemistry of formalin-fixed, paraffin-embedded human testis tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

WB Suggested Anti-KLB Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.