GABRP Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: GABRP Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB327619
• Hersteller Artikelnummer: orb327619
• Alternativnummer: BYT-ORB327619-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP
• Konjugation: Unconjugated
• Alternative Synonym: anti MGC126386 antibody, anti MGC126387 antibody

Produktbeschreibung

Rabbit polyclonal antibody to GABRP

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 51 kDa
• NCBI: 055026
• UniProt: O00591
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
• Target-Kategorie: GABRP

Bilder

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1 ug/mL.

Positive control (+): Human esophagus (ES), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.

Human Intestine

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/mL.

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.