GABRP Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: GABRP Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB327619
• Supplier Catalog Number: orb327619
• Alternative Catalog Number: BYT-ORB327619-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP
• Conjugation: Unconjugated
• Alternative Names: anti MGC126386 antibody, anti MGC126387 antibody

Product Description

Rabbit polyclonal antibody to GABRP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 51 kDa
• NCBI: 055026
• UniProt: O00591
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
• Target: GABRP

Images

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1 ug/mL.

Positive control (+): Human esophagus (ES), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.

Human Intestine

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/mL.

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.