FOSL1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329599
- Bilder (8)
| Artikelname: | FOSL1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329599 |
| Hersteller Artikelnummer: | orb329599 |
| Alternativnummer: | BYT-ORB329599-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human FOSL1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti FRA1 antibody, anti fra-1 antibody, anti FRA antibody |
| Rabbit polyclonal antibody to FOSL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 29kDa |
| NCBI: | 005429 |
| UniProt: | P15407 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK |
| Target-Kategorie: | FOSL1 |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL. |
|
|
Human Skin |
|
|
Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0 ug/mL using anti-FOSL1 antibody (orb329599). |
|
|
Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
|
Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
|
Rabbit Anti-FOSL1 Antibody, Catalog Number: orb329599, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec. |
|
|
WB Suggested Anti-FOSL1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
