FOSL1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329599
| Article Name: |
FOSL1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB329599 |
| Supplier Catalog Number: |
orb329599 |
| Alternative Catalog Number: |
BYT-ORB329599-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human FOSL1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti FRA1 antibody, anti fra-1 antibody, anti FRA antibody |
| Rabbit polyclonal antibody to FOSL1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
29kDa |
| NCBI: |
005429 |
| UniProt: |
P15407 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK |
| Target: |
FOSL1 |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL. |
|
Human Skin |
|
Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0 ug/mL using anti-FOSL1 antibody (orb329599). |
|
Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
Rabbit Anti-FOSL1 Antibody, Catalog Number: orb329599, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec. |
|
WB Suggested Anti-FOSL1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. |