EYA1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: EYA1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB329658
• Hersteller Artikelnummer: orb329658
• Alternativnummer: BYT-ORB329658-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EYA1
• Konjugation: Unconjugated
• Alternative Synonym: anti BOP antibody, anti BOR antibody, anti MGC141875 antibody

Produktbeschreibung

Rabbit polyclonal antibody to EYA1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 64 kDa
• NCBI: 742057
• UniProt: Q99502
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP
• Target-Kategorie: EYA1

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human ACHN Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-EYA1 antibody (orb329658).

WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.