EYA1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: EYA1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB329658
• Supplier Catalog Number: orb329658
• Alternative Catalog Number: BYT-ORB329658-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EYA1
• Conjugation: Unconjugated
• Alternative Names: anti BOP antibody, anti BOR antibody, anti MGC141875 antibody

Product Description

Rabbit polyclonal antibody to EYA1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 64 kDa
• NCBI: 742057
• UniProt: Q99502
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP
• Target: EYA1

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human ACHN Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-EYA1 antibody (orb329658).

WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.