HOXA5 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: HOXA5 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB330051
• Hersteller Artikelnummer: orb330051
• Alternativnummer: BYT-ORB330051-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXA5
• Konjugation: Unconjugated
• Alternative Synonym: anti HOX1 antibody, anti HOX1.3 antibody, anti HOX1C antibody, anti MGC9376 antibody

Produktbeschreibung

Rabbit polyclonal antibody to HOXA5

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 29 kDa
• NCBI: 061975
• UniProt: A2D5Y4
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG
• Target-Kategorie: HOXA5

Bilder

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Anti-HOXA5 antibody IHC staining of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-HOXA5 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 5 ug/mL.

Positive control (+): THP-1 (N30), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.

Rabbit Anti-HOXA5 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-HOXA5 Antibody Titration: 1 ug/mL, Positive Control: Placenta.