HOXA5 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB330051
Article Name: HOXA5 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB330051
Supplier Catalog Number: orb330051
Alternative Catalog Number: BYT-ORB330051-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXA5
Conjugation: Unconjugated
Alternative Names: anti HOX1 antibody, anti HOX1.3 antibody, anti HOX1C antibody, anti MGC9376 antibody
Rabbit polyclonal antibody to HOXA5
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 29 kDa
NCBI: 061975
UniProt: A2D5Y4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG
Target: HOXA5
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Anti-HOXA5 antibody IHC staining of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.
Anti-HOXA5 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 5 ug/mL.
Positive control (+): THP-1 (N30), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.
Rabbit Anti-HOXA5 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-HOXA5 Antibody Titration: 1 ug/mL, Positive Control: Placenta.