Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
Target-Kategorie:
GPSM2
Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
GPSM2 antibody - N-terminal region (orb330634) validated by WB using Fetal Liver Lysate at 1 ug/ml.
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.
Positive control (+): Human lung (LU), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.
IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.