GPSM2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: GPSM2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB330634
• Supplier Catalog Number: orb330634
• Alternative Catalog Number: BYT-ORB330634-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPSM2
• Conjugation: Unconjugated
• Alternative Names: anti LGN antibody, anti Pins antibody, anti PINS antibody, anti DFNB82 antibody

Product Description

Rabbit polyclonal antibody to GPSM2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 76kDa
• NCBI: 037428
• UniProt: P81274
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
• Target: GPSM2

Images

Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

GPSM2 antibody - N-terminal region (orb330634) validated by WB using Fetal Liver Lysate at 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-GPSM2 Antibody, Paraffin Embedded Tissue: Human Liver, Antibody Concentration: 5 ug/ml.